PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g087920.2.1
Common NameLOC101245226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 384aa    MW: 43369.5 Da    PI: 6.9082
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g087920.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.3e-52141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yLk+k+++++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++
  Solyc02g087920.2.1  14 MLPGFRFHPTDEELVGFYLKRKIQQRSLPI-ELIKQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP 103
                         579***************************.89***************9888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfy+gra +g ktdW+mhe+rl
  Solyc02g087920.2.1 104 IYSSdSTKCIGLKKSLVFYRGRAARGIKTDWMMHEFRL 141
                         ***955666***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5811173IPR003441NAC domain
PROSITE profilePS5100557.15414173IPR003441NAC domain
PfamPF023651.4E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDDKSDVEKL DEVMLPGFRF HPTDEELVGF YLKRKIQQRS LPIELIKQVD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSDST KCIGLKKSLV  120
FYRGRAARGI KTDWMMHEFR LPTTNNESGP PKKFLEKNFP PNDSWAICRI FKKTNSMANR  180
ALSYAWGNPL SEVASPELFN QSANAHFVSE NVSSITETGT ALHLSNNNDL LQGASNVPSY  240
KSLNAMASRP SYLSSPSTDI SYNFMFSSPE VSGQNNRCLL DANSMFFNTS PALITDISKT  300
SESIDFDGSN QQLKMQTSIS MENDEAGLKS NRTSINDNTE WENMRSVGFP FSLAEEWKPS  360
LSWDSPPCPS EISTSFSTNK CYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-531617617171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1225440.0Genomic sequence for Lycopersicon esculentum, clone L136C6, complete sequence
GenBankAC2265070.0Solanum lycopersicum chromosome 2 clone C02HBa0136C06, complete sequence
GenBankEU1612830.0Solanum lycopersicum clone BAC L136C6 transcription factor style2.1 gene, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233682.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW51e-101NAC94_ARATH; Putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-100FEZ_ARATH; Protein FEZ
TrEMBLK4BBU80.0K4BBU8_SOLLC; Uncharacterized protein
STRINGSolyc02g087920.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-102NAC domain containing protein 94
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]